![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
![]() | Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
![]() | Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
![]() | Protein Protein S [49706] (1 species) duplication consists of two domains of this fold |
![]() | Species Myxococcus xanthus [TaxId:34] [49707] (3 PDB entries) |
![]() | Domain d1prra1: 1prr A:1-90 [23623] complexed with ca |
PDB Entry: 1prr (more details)
SCOPe Domain Sequences for d1prra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1prra1 b.11.1.1 (A:1-90) Protein S {Myxococcus xanthus [TaxId: 34]} manitvfynedfqgkqvdlppgnytraqlaalgienntissvkvppgvkailyqndgfag dqievvanaeelgplnnnvssirvisvpvq
Timeline for d1prra1: