Lineage for d4n6sa_ (4n6s A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979033Protein Phycocyanin alpha subunit [88933] (9 species)
  7. 1979090Species Synechococcus vulcanus [TaxId:32053] [88938] (8 PDB entries)
  8. 1979096Domain d4n6sa_: 4n6s A: [236224]
    Other proteins in same PDB: d4n6sb_
    automated match to d1ktpa_
    complexed with cyc

Details for d4n6sa_

PDB Entry: 4n6s (more details), 2.4 Å

PDB Description: Crystals of cross-linked stabilized and functional Phycobilisomes: only phycocyanin rods contribute to diffraction.
PDB Compounds: (A:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d4n6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n6sa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus [TaxId: 32053]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

SCOPe Domain Coordinates for d4n6sa_:

Click to download the PDB-style file with coordinates for d4n6sa_.
(The format of our PDB-style files is described here.)

Timeline for d4n6sa_: