SCOPe 2.05: Domain d4n6sa_: 4n6s A:

Lineage for d4n6sa_ (4n6s A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin alpha subunit [88933] (9 species)

7. Species Synechococcus vulcanus [TaxId:32053] [88938] (8 PDB entries)

8. Domain d4n6sa_: 4n6s A: [236224]
   Other proteins in same PDB: d4n6sb_
   automated match to d1ktpa_
   complexed with cyc

Details for d4n6sa_

PDB Entry: 4n6s, 2.4 Å

PDB Description: Crystals of cross-linked stabilized and functional Phycobilisomes: only phycocyanin rods contribute to diffraction.

PDB Compounds: (A:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d4n6sa_:

Sequence; same for both SEQRES and ATOM records:

>d4n6sa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus [TaxId: 32053]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d4n6sa_:

• d4n6sa_ first appeared in SCOPe 2.03
  
• d4n6sa_ appears in SCOPe 2.04
  
• d4n6sa_ appears in SCOPe 2.06
  
• d4n6sa_ appears in the current release, SCOPe 2.08