Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycocyanin beta subunit [88940] (8 species) |
Species Synechococcus vulcanus [TaxId:32053] [88944] (6 PDB entries) |
Domain d4n6sb_: 4n6s B: [236223] Other proteins in same PDB: d4n6sa_ automated match to d1ktpb_ complexed with cyc |
PDB Entry: 4n6s (more details), 2.4 Å
SCOPe Domain Sequences for d4n6sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n6sb_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus vulcanus [TaxId: 32053]} mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava
Timeline for d4n6sb_: