Lineage for d4n6sb_ (4n6s B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2688957Protein Phycocyanin beta subunit [88940] (9 species)
  7. 2688994Species Synechococcus vulcanus [TaxId:32053] [88944] (6 PDB entries)
  8. 2688999Domain d4n6sb_: 4n6s B: [236223]
    Other proteins in same PDB: d4n6sa_
    automated match to d1ktpb_
    complexed with cyc

Details for d4n6sb_

PDB Entry: 4n6s (more details), 2.4 Å

PDB Description: Crystals of cross-linked stabilized and functional Phycobilisomes: only phycocyanin rods contribute to diffraction.
PDB Compounds: (B:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d4n6sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n6sb_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus vulcanus [TaxId: 32053]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

SCOPe Domain Coordinates for d4n6sb_:

Click to download the PDB-style file with coordinates for d4n6sb_.
(The format of our PDB-style files is described here.)

Timeline for d4n6sb_: