SCOPe 2.06: Domain d4mvnd_: 4mvn D:

Lineage for d4mvnd_ (4mvn D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (24 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [193276] (6 PDB entries)

8. Domain d4mvnd_: 4mvn D: [236219]
   automated match to d3ufab_
   complexed with i1s

Details for d4mvnd_

PDB Entry: 4mvn, 1.7 Å

PDB Description: Crystal structure of the staphylococcal serine protease SplA in complex with a specific phosphonate inhibitor

PDB Compounds: (D:) serine protease spla

SCOPe Domain Sequences for d4mvnd_:

Sequence; same for both SEQRES and ATOM records:

>d4mvnd_ b.47.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]}
eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk
gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk
gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek
nfgvyftpqlkefiqnniek

Timeline for d4mvnd_:

• d4mvnd_ first appeared in SCOPe 2.03
  
• d4mvnd_ appears in SCOPe 2.05
  
• d4mvnd_ appears in SCOPe 2.07
  
• d4mvnd_ appears in the current release, SCOPe 2.08