Lineage for d4mvnb_ (4mvn B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (26 species)
    not a true protein
  7. 2390509Species Staphylococcus aureus [TaxId:93061] [193276] (6 PDB entries)
  8. 2390511Domain d4mvnb_: 4mvn B: [236218]
    automated match to d3ufab_
    complexed with i1s

Details for d4mvnb_

PDB Entry: 4mvn (more details), 1.7 Å

PDB Description: Crystal structure of the staphylococcal serine protease SplA in complex with a specific phosphonate inhibitor
PDB Compounds: (B:) serine protease spla

SCOPe Domain Sequences for d4mvnb_:

Sequence, based on SEQRES records: (download)

>d4mvnb_ b.47.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk
gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk
gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek
nfgvyftpqlkefiqnniek

Sequence, based on observed residues (ATOM records): (download)

>d4mvnb_ b.47.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgg
ggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypkg
aqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesekn
fgvyftpqlkefiqnniek

SCOPe Domain Coordinates for d4mvnb_:

Click to download the PDB-style file with coordinates for d4mvnb_.
(The format of our PDB-style files is described here.)

Timeline for d4mvnb_: