SCOPe 2.05: Domain d4ma8l2: 4ma8 L:108-213

Lineage for d4ma8l2 (4ma8 L:108-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d4ma8l2: 4ma8 L:108-213 [236216]
   Other proteins in same PDB: d4ma8l1
   automated match to d4dgil2
   complexed with z80

Details for d4ma8l2

PDB Entry: 4ma8, 2.2 Å

PDB Description: crystal structure of mouse prion protein complexed with chlorpromazine

PDB Compounds: (L:) POM1 light chain

SCOPe Domain Sequences for d4ma8l2:

Sequence; same for both SEQRES and ATOM records:

>d4ma8l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqd
skdstysmsstltltkdeyerhntytceathktstspivksfnrne

Timeline for d4ma8l2:

• d4ma8l2 first appeared in SCOPe 2.03
  
• d4ma8l2 appears in SCOPe 2.04
  
• d4ma8l2 appears in SCOPe 2.06
  
• d4ma8l2 appears in the current release, SCOPe 2.08