Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
Protein automated matches [191036] (16 species) not a true protein |
Species Chlamydia trachomatis [TaxId:471472] [230253] (2 PDB entries) |
Domain d4mpog_: 4mpo G: [236212] automated match to d4ilqa_ complexed with amp, cl, mg, po4 |
PDB Entry: 4mpo (more details), 1.9 Å
SCOPe Domain Sequences for d4mpog_:
Sequence, based on SEQRES records: (download)
>d4mpog_ d.113.1.0 (G:) automated matches {Chlamydia trachomatis [TaxId: 471472]} kheysfgvipirffgtpdrstlkacfichtdgkhwgfpkghaeekegpqeaaerelveet glgivnffpkifvenysfndkeeifvrkevtyflaevkgevhadpdeicdvqwlsfqegl rllnfpeirnivteadkfvqsylf
>d4mpog_ d.113.1.0 (G:) automated matches {Chlamydia trachomatis [TaxId: 471472]} kheysfgvipirffdrstlkacfichtdgkhwgfpkghaeekegpqeaaerelveetglg ivnffpkifvenysfnfvrkevtyflaevkgevhadpdeicdvqwlsfqeglrllnfpei rnivteadkfvqsylf
Timeline for d4mpog_: