Lineage for d4mpof_ (4mpo F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428504Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1428505Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1428789Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 1428790Protein automated matches [191036] (8 species)
    not a true protein
  7. 1428806Species Chlamydia trachomatis [TaxId:471472] [230253] (2 PDB entries)
  8. 1428812Domain d4mpof_: 4mpo F: [236210]
    automated match to d4ilqa_
    complexed with amp, cl, mg, po4

Details for d4mpof_

PDB Entry: 4mpo (more details), 1.9 Å

PDB Description: 1.90 a resolution structure of ct771 from chlamydia trachomatis bound to hydrolyzed ap4a products
PDB Compounds: (F:) ct771

SCOPe Domain Sequences for d4mpof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mpof_ d.113.1.0 (F:) automated matches {Chlamydia trachomatis [TaxId: 471472]}
kheysfgvipirffgtpdrstlkacfichtdgkhwgfpkghaeekegpqeaaerelveet
glgivnffpkifvenysfndkeeifvrkevtyflaevkgevhadpdeicdvqwlsfqegl
rllnfpeirnivteadkfvqsy

SCOPe Domain Coordinates for d4mpof_:

Click to download the PDB-style file with coordinates for d4mpof_.
(The format of our PDB-style files is described here.)

Timeline for d4mpof_: