Lineage for d4mpod_ (4mpo D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2578347Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2578348Protein automated matches [191036] (17 species)
    not a true protein
  7. 2578385Species Chlamydia trachomatis [TaxId:471472] [230253] (2 PDB entries)
  8. 2578389Domain d4mpod_: 4mpo D: [236208]
    automated match to d4ilqa_
    complexed with amp, cl, mg, po4

Details for d4mpod_

PDB Entry: 4mpo (more details), 1.9 Å

PDB Description: 1.90 a resolution structure of ct771 from chlamydia trachomatis bound to hydrolyzed ap4a products
PDB Compounds: (D:) ct771

SCOPe Domain Sequences for d4mpod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mpod_ d.113.1.0 (D:) automated matches {Chlamydia trachomatis [TaxId: 471472]}
tkheysfgvipirffgtpdrstlkacfichtdgkhwgfpkghaeekegpqeaaerelvee
tglgivnffpkifvenysfndkeeifvrkevtyflaevkgevhadpdeicdvqwlsfqeg
lrllnfpeirnivteadkfvqsylf

SCOPe Domain Coordinates for d4mpod_:

Click to download the PDB-style file with coordinates for d4mpod_.
(The format of our PDB-style files is described here.)

Timeline for d4mpod_: