SCOPe 2.05: Domain d1e7na_: 1e7n A:

Lineage for d1e7na_ (1e7n A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein beta-Crystallin [49702] (4 species)
   duplication consists of two domains of this fold

7. Species Mouse (Mus musculus) [TaxId:10090] [49705] (1 PDB entry)

8. Domain d1e7na_: 1e7n A: [23620]
   N-terminal domain only

Details for d1e7na_

PDB Entry: 1e7n, 2.35 Å

PDB Description: the n-terminal domain of beta-b2-crystallin resembles the putative ancestral homodimer

PDB Compounds: (A:) beta-crystallin b2

SCOPe Domain Sequences for d1e7na_:

Sequence; same for both SEQRES and ATOM records:

>d1e7na_ b.11.1.1 (A:) beta-Crystallin {Mouse (Mus musculus) [TaxId: 10090]}
lnpkiiifeqenfqghshelsgpcpnlketgmekagsvlvqagpwvgyeqanckgeqfvf
ekgeyprwdswtssrrtdslsslrpikvd

Timeline for d1e7na_:

• d1e7na_ first appeared (with stable ids) in SCOP 1.55
  
• d1e7na_ appears in SCOPe 2.04
  
• d1e7na_ appears in SCOPe 2.06
  
• d1e7na_ appears in the current release, SCOPe 2.08