Lineage for d1e7na_ (1e7n A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) Superfamily b.11.1: gamma-Crystallin-like [49695] (5 families) 
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) 
Protein beta-Crystallin [49702] (3 species) 
Species Mouse (Mus musculus) [TaxId:10090] [49705] (1 PDB entry) 
Domain d1e7na_: 1e7n A: [23620]
Details for d1e7na_
PDB Entry: 1e7n (more details), 2.35 Å
PDB Description: the n-terminal domain of beta-b2-crystallin resembles the putative ancestral homodimer
SCOP Domain Sequences for d1e7na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7na_ b.11.1.1 (A:) beta-Crystallin {Mouse (Mus musculus)}
lnpkiiifeqenfqghshelsgpcpnlketgmekagsvlvqagpwvgyeqanckgeqfvf
ekgeyprwdswtssrrtdslsslrpikvd
SCOP Domain Coordinates for d1e7na_:
Click to download the PDB-style file with coordinates for d1e7na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e7na_:
- d1e7na_ appears in SCOP 1.57
- d1e7na_ appears in the current release, SCOPe 2.08
View in 3D
