![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries) |
![]() | Domain d4m11a1: 4m11 A:33-73 [236198] Other proteins in same PDB: d4m11a2, d4m11b2, d4m11c2, d4m11d2 automated match to d1ddxa2 complexed with bog, hem, mxm, nag |
PDB Entry: 4m11 (more details), 2.45 Å
SCOPe Domain Sequences for d4m11a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m11a1 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
Timeline for d4m11a1: