SCOPe 2.06: Domain d4m11b1: 4m11 B:33-73

Lineage for d4m11b1 (4m11 B:33-73)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (12 PDB entries)

8. Domain d4m11b1: 4m11 B:33-73 [236197]
   Other proteins in same PDB: d4m11a2, d4m11b2, d4m11c2, d4m11d2
   automated match to d1ddxa2
   complexed with bog, hem, mxm, nag

Details for d4m11b1

PDB Entry: 4m11, 2.45 Å

PDB Description: crystal structure of murine cyclooxygenase-2 complex with meloxicam

PDB Compounds: (B:) Prostaglandin G/H synthase 2

SCOPe Domain Sequences for d4m11b1:

Sequence; same for both SEQRES and ATOM records:

>d4m11b1 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d4m11b1:

• d4m11b1 first appeared in SCOPe 2.03
  
• d4m11b1 appears in SCOPe 2.05
  
• d4m11b1 appears in SCOPe 2.07
  
• d4m11b1 appears in the current release, SCOPe 2.08