Lineage for d4m11b1 (4m11 B:33-73)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031550Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 3031551Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)
  8. 3031558Domain d4m11b1: 4m11 B:33-73 [236197]
    Other proteins in same PDB: d4m11a2, d4m11b2, d4m11c2, d4m11d2
    automated match to d1ddxa2
    complexed with bog, hem, mxm, nag

Details for d4m11b1

PDB Entry: 4m11 (more details), 2.45 Å

PDB Description: crystal structure of murine cyclooxygenase-2 complex with meloxicam
PDB Compounds: (B:) Prostaglandin G/H synthase 2

SCOPe Domain Sequences for d4m11b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m11b1 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d4m11b1:

Click to download the PDB-style file with coordinates for d4m11b1.
(The format of our PDB-style files is described here.)

Timeline for d4m11b1: