SCOPe 2.08: Domain d4l7sb1: 4l7s B:357-620

Lineage for d4l7sb1 (4l7s B:357-620)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
   PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
   Uniprot Q08881 357-619

8. Domain d4l7sb1: 4l7s B:357-620 [236196]
   Other proteins in same PDB: d4l7sa2, d4l7sb2
   automated match to d4kioc_
   complexed with g7k, so4; mutant

Details for d4l7sb1

PDB Entry: 4l7s, 2.03 Å

PDB Description: Kinase domain mutant of human Itk in complex with an aminobenzothiazole inhibitor

PDB Compounds: (B:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4l7sb1:

Sequence, based on SEQRES records:

>d4l7sb1 d.144.1.7 (B:357-620) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaeiaesgl

Sequence, based on observed residues (ATOM records):

>d4l7sb1 d.144.1.7 (B:357-620) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtpvkwaspevfsfsryssksdvwsfgvlmwevf
segkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrql
aeiaesgl

Timeline for d4l7sb1:

• d4l7sb1 first appeared in SCOPe 2.03, called d4l7sb_
  
• d4l7sb1 appears in SCOPe 2.07