Lineage for d4l7sa1 (4l7s A:357-620)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544952Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 2544953Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 2544970Domain d4l7sa1: 4l7s A:357-620 [236195]
    Other proteins in same PDB: d4l7sa2, d4l7sb2
    automated match to d4kioc_
    complexed with g7k, so4; mutant

Details for d4l7sa1

PDB Entry: 4l7s (more details), 2.03 Å

PDB Description: Kinase domain mutant of human Itk in complex with an aminobenzothiazole inhibitor
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4l7sa1:

Sequence, based on SEQRES records: (download)

>d4l7sa1 d.144.1.7 (A:357-620) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaeiaesgl

Sequence, based on observed residues (ATOM records): (download)

>d4l7sa1 d.144.1.7 (A:357-620) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtpvkwaspevfsfsryssksdvwsfgvlmwevf
segkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrql
aeiaesgl

SCOPe Domain Coordinates for d4l7sa1:

Click to download the PDB-style file with coordinates for d4l7sa1.
(The format of our PDB-style files is described here.)

Timeline for d4l7sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l7sa2