![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species) PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries) Uniprot Q08881 357-619 |
![]() | Domain d4l7sa1: 4l7s A:357-620 [236195] Other proteins in same PDB: d4l7sa2, d4l7sb2 automated match to d4kioc_ complexed with g7k, so4; mutant |
PDB Entry: 4l7s (more details), 2.03 Å
SCOPe Domain Sequences for d4l7sa1:
Sequence, based on SEQRES records: (download)
>d4l7sa1 d.144.1.7 (A:357-620) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea cvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsrys sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk erpedrpafsrllrqlaeiaesgl
>d4l7sa1 d.144.1.7 (A:357-620) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea cvihrdlaarnclvgenqvikvsdfgmtpvkwaspevfsfsryssksdvwsfgvlmwevf segkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrql aeiaesgl
Timeline for d4l7sa1: