Lineage for d4leja2 (4lej A:232-454)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080920Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2080921Protein automated matches [190388] (23 species)
    not a true protein
  7. 2080987Species Pinus koraiensis [TaxId:88728] [236190] (1 PDB entry)
  8. 2080989Domain d4leja2: 4lej A:232-454 [236194]
    automated match to d1ipkc2
    complexed with cu, gol, po4

Details for d4leja2

PDB Entry: 4lej (more details), 2.4 Å

PDB Description: crystal structure of the korean pine (pinus koraiensis) vicilin
PDB Compounds: (A:) Vicilin

SCOPe Domain Sequences for d4leja2:

Sequence, based on SEQRES records: (download)

>d4leja2 b.82.1.0 (A:232-454) automated matches {Pinus koraiensis [TaxId: 88728]}
hrrgvifyaneeqiremmrrggfsaestsaseqpkpfnlrnqkpdfendngrftragpkd
npfldsvdvtvgfgvlnpgtmtapshntkatsiaivmegegriemacphlgqehgwsspr
erghqdinyervrarlrtgtvyvvpaghpiteiastngrleilwfdintsgnereflagk
nnvlqtlekevrhlsfniprgeeieevlqaqkdqvilrgpqrq

Sequence, based on observed residues (ATOM records): (download)

>d4leja2 b.82.1.0 (A:232-454) automated matches {Pinus koraiensis [TaxId: 88728]}
hrrgvifyaseqpkpfnlrnqkpdfendngrftragpkdnpfldsvdvtvgfgvlnpgtm
tapshntkatsiaivmegegriemacphlqdinyervrarlrtgtvyvvpaghpiteias
tngrleilwfdintsgnereflagknnvlqtlekevrhlsfniprgeeieevlqaqkdqv
ilrgpqrq

SCOPe Domain Coordinates for d4leja2:

Click to download the PDB-style file with coordinates for d4leja2.
(The format of our PDB-style files is described here.)

Timeline for d4leja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4leja1