Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (23 species) not a true protein |
Species Pinus koraiensis [TaxId:88728] [236190] (1 PDB entry) |
Domain d4leja2: 4lej A:232-454 [236194] automated match to d1ipkc2 complexed with cu, gol, po4 |
PDB Entry: 4lej (more details), 2.4 Å
SCOPe Domain Sequences for d4leja2:
Sequence, based on SEQRES records: (download)
>d4leja2 b.82.1.0 (A:232-454) automated matches {Pinus koraiensis [TaxId: 88728]} hrrgvifyaneeqiremmrrggfsaestsaseqpkpfnlrnqkpdfendngrftragpkd npfldsvdvtvgfgvlnpgtmtapshntkatsiaivmegegriemacphlgqehgwsspr erghqdinyervrarlrtgtvyvvpaghpiteiastngrleilwfdintsgnereflagk nnvlqtlekevrhlsfniprgeeieevlqaqkdqvilrgpqrq
>d4leja2 b.82.1.0 (A:232-454) automated matches {Pinus koraiensis [TaxId: 88728]} hrrgvifyaseqpkpfnlrnqkpdfendngrftragpkdnpfldsvdvtvgfgvlnpgtm tapshntkatsiaivmegegriemacphlqdinyervrarlrtgtvyvvpaghpiteias tngrleilwfdintsgnereflagknnvlqtlekevrhlsfniprgeeieevlqaqkdqv ilrgpqrq
Timeline for d4leja2: