SCOPe 2.03: Domain d4leja1: 4lej A:65-231

Lineage for d4leja1 (4lej A:65-231)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (15 species)
   not a true protein

7. Species Pinus koraiensis [TaxId:88728] [236190] (1 PDB entry)

8. Domain d4leja1: 4lej A:65-231 [236193]
   automated match to d1ipkc1
   complexed with cu, gol, po4

Details for d4leja1

PDB Entry: 4lej, 2.4 Å

PDB Description: crystal structure of the korean pine (pinus koraiensis) vicilin

PDB Compounds: (A:) Vicilin

SCOPe Domain Sequences for d4leja1:

Sequence; same for both SEQRES and ATOM records:

>d4leja1 b.82.1.0 (A:65-231) automated matches {Pinus koraiensis [TaxId: 88728]}
npyvfhsdrfrirasseageiralpnfgevsellegisryrvtciemkpntvmlphyida
kwilyvtggrgyiayvqqnelvkrkleegdvfgvpsghtfylvnnddhnslriasllrte
stmrgeyepfyvaggrnpetvysafsddvleaafntdvqklehifga

Timeline for d4leja1:

• d4leja1 is new in SCOPe 2.03-stable
  
• d4leja1 appears in SCOPe 2.04
  
• d4leja1 appears in the current release, SCOPe 2.08