Lineage for d1bd7b_ (1bd7 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773467Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 2773489Species Norway rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries)
  8. 2773503Domain d1bd7b_: 1bd7 B: [23619]
    circularly permuted sequence
    multiple common domains: applies to families that are inconsistently divided into domains

Details for d1bd7b_

PDB Entry: 1bd7 (more details), 2.78 Å

PDB Description: circularly permuted bb2-crystallin
PDB Compounds: (B:) circularly permuted bb2-crystallin

SCOPe Domain Sequences for d1bd7b_:

Sequence, based on SEQRES records: (download)

>d1bd7b_ b.11.1.1 (B:) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]}
ehkiilyenpnftgkkmeivdddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyl
lekgdykdnsdfgaphpqvqsvrrirdmqgnpkiiifeqenfqghshelsgpcpnlketg
mekagsvlvqagpwvgyeqanckgeqfvfekgeyprwdswtssrrtdslsslrpik

Sequence, based on observed residues (ATOM records): (download)

>d1bd7b_ b.11.1.1 (B:) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]}
ehkiilyenpnftgkkmeivdddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyl
lekgdykdnsdfgaphpqvqsvrrirdmqgnpkiiifeqenfqghshelsgpcpnlketg
mekagsvlvqagpwvgyeqanckgeqfvfekgeyprwdswtdslsslrpik

SCOPe Domain Coordinates for d1bd7b_:

Click to download the PDB-style file with coordinates for d1bd7b_.
(The format of our PDB-style files is described here.)

Timeline for d1bd7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bd7a_