Class b: All beta proteins [48724] (180 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
Protein beta-Crystallin [49702] (4 species) duplication consists of two domains of this fold |
Species Norway rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries) |
Domain d1bd7b_: 1bd7 B: [23619] circularly permuted sequence multiple common domains: applies to families that are inconsistently divided into domains |
PDB Entry: 1bd7 (more details), 2.78 Å
SCOPe Domain Sequences for d1bd7b_:
Sequence, based on SEQRES records: (download)
>d1bd7b_ b.11.1.1 (B:) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]} ehkiilyenpnftgkkmeivdddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyl lekgdykdnsdfgaphpqvqsvrrirdmqgnpkiiifeqenfqghshelsgpcpnlketg mekagsvlvqagpwvgyeqanckgeqfvfekgeyprwdswtssrrtdslsslrpik
>d1bd7b_ b.11.1.1 (B:) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]} ehkiilyenpnftgkkmeivdddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyl lekgdykdnsdfgaphpqvqsvrrirdmqgnpkiiifeqenfqghshelsgpcpnlketg mekagsvlvqagpwvgyeqanckgeqfvfekgeyprwdswtdslsslrpik
Timeline for d1bd7b_: