![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
![]() | Protein Putative deaminase NE0047 [142833] (1 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [142834] (12 PDB entries) Uniprot Q82Y41 1-189 |
![]() | Domain d4lc5a_: 4lc5 A: [236188] Other proteins in same PDB: d4lc5b2 automated match to d2g84a1 complexed with 9mg, edo, zn |
PDB Entry: 4lc5 (more details), 1.97 Å
SCOPe Domain Sequences for d4lc5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lc5a_ c.97.1.2 (A:) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]} mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll iaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgavi wsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynac ngviynarc
Timeline for d4lc5a_: