SCOPe 2.03: Domain d4ld2a_: 4ld2 A:

Lineage for d4ld2a_ (4ld2 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Putative deaminase NE0047 [142833] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [142834] (8 PDB entries)
   Uniprot Q82Y41 1-189

8. Domain d4ld2a_: 4ld2 A: [236185]
   automated match to d2g84a1
   complexed with ctn, edo, zn

Details for d4ld2a_

PDB Entry: 4ld2, 1.55 Å

PDB Description: Crystal structure of NE0047 in complex with cytidine

PDB Compounds: (A:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOPe Domain Sequences for d4ld2a_:

Sequence; same for both SEQRES and ATOM records:

>d4ld2a_ c.97.1.2 (A:) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
ndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsglli
aagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgaviw
sgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynacn
gviynarc

Timeline for d4ld2a_:

• d4ld2a_ is new in SCOPe 2.03-stable
  
• d4ld2a_ appears in SCOPe 2.04
  
• d4ld2a_ appears in the current release, SCOPe 2.08