SCOPe 2.08: Domain d4lc5b1: 4lc5 B:1-180

Lineage for d4lc5b1 (4lc5 B:1-180)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Putative deaminase NE0047 [142833] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [142834] (12 PDB entries)
   Uniprot Q82Y41 1-189

8. Domain d4lc5b1: 4lc5 B:1-180 [236184]
   Other proteins in same PDB: d4lc5b2
   automated match to d2g84b_
   complexed with 9mg, edo, zn

Details for d4lc5b1

PDB Entry: 4lc5, 1.97 Å

PDB Description: Structural basis of substrate specificity of CDA superfamily guanine deaminase

PDB Compounds: (B:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOPe Domain Sequences for d4lc5b1:

Sequence; same for both SEQRES and ATOM records:

>d4lc5b1 c.97.1.2 (B:1-180) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll
iaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgavi
wsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynac

Timeline for d4lc5b1:

• d4lc5b1 first appeared in SCOPe 2.03, called d4lc5b_
  
• d4lc5b1 appears in SCOPe 2.07