Lineage for d1bd7a_ (1bd7 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11845Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
  4. 11846Superfamily b.11.1: gamma-Crystallin-like [49695] (5 families) (S)
  5. 11847Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
  6. 11848Protein beta-Crystallin [49702] (3 species)
  7. 11863Species Rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (2 PDB entries)
  8. 11868Domain d1bd7a_: 1bd7 A: [23618]

Details for d1bd7a_

PDB Entry: 1bd7 (more details), 2.78 Å

PDB Description: circularly permuted bb2-crystallin

SCOP Domain Sequences for d1bd7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd7a_ b.11.1.1 (A:) beta-Crystallin {Rat (Rattus norvegicus), isoform E}
ehkiilyenpnftgkkmeivdddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyl
lekgdykdnsdfgaphpqvqsvrrirdmqgnpkiiifeqenfqghshelsgpcpnlketg
mekagsvlvqagpwvgyeqanckgeqfvfekgeyprwdswtssrrtdslsslrpik

SCOP Domain Coordinates for d1bd7a_:

Click to download the PDB-style file with coordinates for d1bd7a_.
(The format of our PDB-style files is described here.)

Timeline for d1bd7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bd7b_