Lineage for d4lcob_ (4lco B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882436Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1882437Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1882512Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 1882542Protein Putative deaminase NE0047 [142833] (1 species)
  7. 1882543Species Nitrosomonas europaea [TaxId:915] [142834] (9 PDB entries)
    Uniprot Q82Y41 1-189
  8. 1882559Domain d4lcob_: 4lco B: [236179]
    automated match to d2g84b_
    complexed with 6am, zn

Details for d4lcob_

PDB Entry: 4lco (more details), 2.7 Å

PDB Description: Crystal structure of NE0047 with complex with substrate ammeline
PDB Compounds: (B:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOPe Domain Sequences for d4lcob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lcob_ c.97.1.2 (B:) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
ghmndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsg
lliaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfga
viwsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreyn
ac

SCOPe Domain Coordinates for d4lcob_:

Click to download the PDB-style file with coordinates for d4lcob_.
(The format of our PDB-style files is described here.)

Timeline for d4lcob_: