SCOPe 2.03: Domain d4lbka_: 4lbk A:

Lineage for d4lbka_ (4lbk A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-3 CRD [49940] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49941] (14 PDB entries)

8. Domain d4lbka_: 4lbk A: [236178]
   automated match to d1a3ka_
   complexed with cl; mutant

Details for d4lbka_

PDB Entry: 4lbk, 1.6 Å

PDB Description: crystal structure of human galectin-3 crd k176l mutant in complex with lnnt

PDB Compounds: (A:) Galectin-3

SCOPe Domain Sequences for d4lbka_:

Sequence; same for both SEQRES and ATOM records:

>d4lbka_ b.29.1.3 (A:) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]}
mlivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
cntlldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
klgisgdidltsasytmi

Timeline for d4lbka_:

• d4lbka_ is new in SCOPe 2.03-stable
  
• d4lbka_ appears in SCOPe 2.04
  
• d4lbka_ appears in the current release, SCOPe 2.08, called d4lbka1