| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
| Protein Galectin-3 CRD [49940] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49941] (85 PDB entries) |
| Domain d4lbka1: 4lbk A:114-250 [236178] Other proteins in same PDB: d4lbka2 automated match to d1a3ka_ complexed with cl; mutant |
PDB Entry: 4lbk (more details), 1.6 Å
SCOPe Domain Sequences for d4lbka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lbka1 b.29.1.3 (A:114-250) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]}
livpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc
ntlldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk
lgisgdidltsasytmi
Timeline for d4lbka1: