SCOPe 2.07: Domain d1a5db2: 1a5d B:85-174

Lineage for d1a5db2 (1a5d B:85-174)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein beta-Crystallin [49702] (4 species)
   duplication consists of two domains of this fold

7. Species Norway rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries)

8. Domain d1a5db2: 1a5d B:85-174 [23617]

Details for d1a5db2

PDB Entry: 1a5d, 2.3 Å

PDB Description: gammae crystallin from rat lens

PDB Compounds: (B:) gammae crystallin

SCOPe Domain Sequences for d1a5db2:

Sequence; same for both SEQRES and ATOM records:

>d1a5db2 b.11.1.1 (B:85-174) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]}
sshririyeredyrgqmveitddcphlqdrfhfsdfhsfhvmegywvlyempnyrgrqyl
lrpgeyrryhdwgamnarvgslrrimdfy

Timeline for d1a5db2:

• d1a5db2 first appeared (with stable ids) in SCOP 1.55
  
• d1a5db2 appears in SCOPe 2.06
  
• d1a5db2 appears in the current release, SCOPe 2.08