SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1a5db2 (1a5d B:85-174)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038595Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2038596Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2038597Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 protein domains)
  6. 2038598Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 2038620Species Norway rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries)
  8. 2038632Domain d1a5db2: 1a5d B:85-174 [23617]

Details for d1a5db2

PDB Entry: 1a5d (more details), 2.3 Å

PDB Description: gammae crystallin from rat lens
PDB Compounds: (B:) gammae crystallin

SCOPe Domain Sequences for d1a5db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5db2 b.11.1.1 (B:85-174) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]}
sshririyeredyrgqmveitddcphlqdrfhfsdfhsfhvmegywvlyempnyrgrqyl
lrpgeyrryhdwgamnarvgslrrimdfy

SCOPe Domain Coordinates for d1a5db2:

Click to download the PDB-style file with coordinates for d1a5db2.
(The format of our PDB-style files is described here.)

Timeline for d1a5db2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5db1