SCOPe 2.06: Domain d4iqba_: 4iqb A:

Lineage for d4iqba_ (4iqb A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.0: automated matches [227244] (1 protein)
   not a true family

6. Protein automated matches [227010] (5 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [236135] (6 PDB entries)

8. Domain d4iqba_: 4iqb A: [236140]
   automated match to d1tsla_
   complexed with so4

Details for d4iqba_

PDB Entry: 4iqb, 1.13 Å

PDB Description: high resolution crystal structure of c.elegans thymidylate synthase

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4iqba_:

Sequence; same for both SEQRES and ATOM records:

>d4iqba_ d.117.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qvhlnqdeykylkqveqilregtrrddrtgtgtisifgmqskyclrngtipllttkrvyw
kgvleellwfisgstdgkllmeknvkiwekngdrafldnlgftsreegdlgpvygfqwrh
fgakyvdchtdysgqgvdqlaevirqikeqpdsrriimsawnpsdlgqmvlppchtmcqf
yvdngelscqlyqrsgdmglgvpfnlasygllthmiakvcglkpgtlvhtlgdahvysnh
vdalkiqldrepyafpkirftrdvasiddftsdmialddykchpkipm

Timeline for d4iqba_:

• d4iqba_ first appeared in SCOPe 2.03
  
• d4iqba_ appears in SCOPe 2.05
  
• d4iqba_ appears in SCOPe 2.07
  
• d4iqba_ appears in the current release, SCOPe 2.08