Lineage for d4iqqb_ (4iqq B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428979Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1428980Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1429358Family d.117.1.0: automated matches [227244] (1 protein)
    not a true family
  6. 1429359Protein automated matches [227010] (4 species)
    not a true protein
  7. 1429371Species Caenorhabditis elegans [TaxId:6239] [236135] (3 PDB entries)
  8. 1429377Domain d4iqqb_: 4iqq B: [236138]
    automated match to d1tsla_
    complexed with d16, ump

Details for d4iqqb_

PDB Entry: 4iqq (more details), 2.9 Å

PDB Description: Crystal Structure of C.elegans Thymidylate Synthase in Complex with dUMP and Tomudex
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d4iqqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iqqb_ d.117.1.0 (B:) automated matches {Caenorhabditis elegans [TaxId: 6239]}
qvhlnqdeykylkqveqilregtrrddrtgtgtisifgmqskyclrngtipllttkrvyw
kgvleellwfisgstdgkllmeknvkiwekngdrafldnlgftsreegdlgpvygfqwrh
fgakyvdchtdysgqgvdqlaevirqikeqpdsrriimsawnpsdlgqmvlppchtmcqf
yvdngelscqlyqrsgdmglgvpfnlasygllthmiakvcglkpgtlvhtlgdahvysnh
vdalkiqldrepyafpkirftrdvasiddftsdmialddykchpkipmd

SCOPe Domain Coordinates for d4iqqb_:

Click to download the PDB-style file with coordinates for d4iqqb_.
(The format of our PDB-style files is described here.)

Timeline for d4iqqb_: