SCOPe 2.06: Domain d4iedc_: 4ied C:

Lineage for d4iedc_ (4ied C:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Fusobacterium nucleatum [TaxId:76857] [236129] (1 PDB entry)

8. Domain d4iedc_: 4ied C: [236132]
   automated match to d3fv7a_
   complexed with cl, edo, mg, na

Details for d4iedc_

PDB Entry: 4ied, 1.5 Å

PDB Description: Crystal Structure of FUS-1 (OXA-85), a Class D beta-lactamase from Fusobacterium nucleatum subsp. polymorphum

PDB Compounds: (C:) Class D beta-lactamase

SCOPe Domain Sequences for d4iedc_:

Sequence; same for both SEQRES and ATOM records:

>d4iedc_ e.3.1.0 (C:) automated matches {Fusobacterium nucleatum [TaxId: 76857]}
iisfgnenqfmkeiferkglngtfvvydlkndkidyynldranerfypassfkifntlig
lengivknvdemfyyydgskvfldswakdsnlryaikvsqvpaykklarelgkermqegl
nklnygnkeigseidkfwlegplkisameqvkllnllsqsklpfklenqeqvkditilek
kddfilhgktgwatdnivvpigwfvgwietsdniysfainldisdskflpkreeivreyf
kninvik

Timeline for d4iedc_:

• d4iedc_ first appeared in SCOPe 2.03
  
• d4iedc_ appears in SCOPe 2.05
  
• d4iedc_ appears in SCOPe 2.07
  
• d4iedc_ appears in the current release, SCOPe 2.08