Lineage for d4ck1b_ (4ck1 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493948Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2494110Protein automated matches [190209] (5 species)
    not a true protein
  7. 2494111Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries)
  8. 2494151Domain d4ck1b_: 4ck1 B: [236128]
    automated match to d4ah9a_
    complexed with act, cl, edo, om1, so4

Details for d4ck1b_

PDB Entry: 4ck1 (more details), 1.75 Å

PDB Description: Interrogating HIV integrase for compounds that bind- a SAMPL challenge
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d4ck1b_:

Sequence, based on SEQRES records: (download)

>d4ck1b_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d4ck1b_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkgysagerivdiiatdiq

SCOPe Domain Coordinates for d4ck1b_:

Click to download the PDB-style file with coordinates for d4ck1b_.
(The format of our PDB-style files is described here.)

Timeline for d4ck1b_: