Lineage for d1blbd1 (1blb D:-4-85)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773467Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 2773468Species Cow (Bos taurus) [TaxId:9913] [49703] (2 PDB entries)
  8. 2773477Domain d1blbd1: 1blb D:-4-85 [23612]

Details for d1blbd1

PDB Entry: 1blb (more details), 3.3 Å

PDB Description: close packing of an oligomeric eye lens beta-crystallin induces loss of symmetry and ordering of sequence extensions
PDB Compounds: (D:) beta b2-crystallin

SCOPe Domain Sequences for d1blbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blbd1 b.11.1.1 (D:-4-85) beta-Crystallin {Cow (Bos taurus) [TaxId: 9913]}
qplnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanckgeqf
vfekgeyprwdswtssrrtdslsslrpikvds

SCOPe Domain Coordinates for d1blbd1:

Click to download the PDB-style file with coordinates for d1blbd1.
(The format of our PDB-style files is described here.)

Timeline for d1blbd1: