Lineage for d4cayb_ (4cay B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2698749Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)
  8. 2698751Domain d4cayb_: 4cay B: [236115]
    automated match to d3mgrd_

Details for d4cayb_

PDB Entry: 4cay (more details), 1.48 Å

PDB Description: crystal structure of a human anp32e-h2a.z-h2b complex
PDB Compounds: (B:) Histone H2B type 1-J

SCOPe Domain Sequences for d4cayb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cayb_ a.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsre
iqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d4cayb_:

Click to download the PDB-style file with coordinates for d4cayb_.
(The format of our PDB-style files is described here.)

Timeline for d4cayb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4caya_