Lineage for d1blbc2 (1blb C:86-175)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383151Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2383152Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2383153Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2383154Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 2383155Species Cow (Bos taurus) [TaxId:9913] [49703] (2 PDB entries)
  8. 2383163Domain d1blbc2: 1blb C:86-175 [23611]

Details for d1blbc2

PDB Entry: 1blb (more details), 3.3 Å

PDB Description: close packing of an oligomeric eye lens beta-crystallin induces loss of symmetry and ordering of sequence extensions
PDB Compounds: (C:) beta b2-crystallin

SCOPe Domain Sequences for d1blbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blbc2 b.11.1.1 (C:86-175) beta-Crystallin {Cow (Bos taurus) [TaxId: 9913]}
qehkitlyenpnftgkkmevidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqy
llekgdykdsgdfgapqpqvqsvrrirdmqw

SCOPe Domain Coordinates for d1blbc2:

Click to download the PDB-style file with coordinates for d1blbc2.
(The format of our PDB-style files is described here.)

Timeline for d1blbc2: