Lineage for d4bn2a_ (4bn2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2114372Domain d4bn2a_: 4bn2 A: [236109]
    automated match to d4bn2c_
    complexed with adp, mg

Details for d4bn2a_

PDB Entry: 4bn2 (more details), 2.7 Å

PDB Description: The crystal structure of kinesin-like protein KIF15
PDB Compounds: (A:) kinesin-like protein kif15

SCOPe Domain Sequences for d4bn2a_:

Sequence, based on SEQRES records: (download)

>d4bn2a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdaikvfvrirppaersgsadgeqnlclsvlsstslrlhsnpepktftfdhvadvdttqe
svfatvaksivescmsgyngtifaygqtgsgktftmmgpsesdnfshnlrgviprsfeyl
fslidrekekagagksflckcsfieiyneqiydlldsasaglylrehikkgvfvvgaveq
vvtsaaeayqvlsggwrnrrvastsmnressrshavftitiesmeksneivnirtsllnl
vdlagserqkdthaegmrlkeagninrslsclgqvitalvdvgngkqrhvcyrdskltfl
lrdslggnaktaiianvhpgsrcfgetlstlnfaqrakliknkavvnedtqg

Sequence, based on observed residues (ATOM records): (download)

>d4bn2a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdaikvfvrirppaersqnlclsvlsstslrlhsnpepktftfdhvadvdttqesvfatv
aksivescmsgyngtifaygqtgsgktftmmgpsesdnfshnlrgviprsfeylfslidr
ekgksflckcsfieiyneqiydlldsasaglylrehikkgvfvvgaveqvvtsaaeayqv
lsggwrnrrvastsmnressrshavftitiesmeksneivnirtsllnlvdlagsernin
rslsclgqvitalvdvgngkqrhvcyrdskltfllrdslggnaktaiianvhpgsrcfge
tlstlnfaqrakliknkavvnedtqg

SCOPe Domain Coordinates for d4bn2a_:

Click to download the PDB-style file with coordinates for d4bn2a_.
(The format of our PDB-style files is described here.)

Timeline for d4bn2a_: