SCOPe 2.06: Domain d3zhgd_: 3zhg D:

Lineage for d3zhgd_ (3zhg D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (21 PDB entries)

8. Domain d3zhgd_: 3zhg D: [236106]
   automated match to d1t8da1
   complexed with ca, so4

Details for d3zhgd_

PDB Entry: 3zhg, 1.87 Å

PDB Description: crystallographic structure of the native mouse sign-r1 crd domain

PDB Compounds: (D:) cd209 antigen-like protein b

SCOPe Domain Sequences for d3zhgd_:

Sequence; same for both SEQRES and ATOM records:

>d3zhgd_ d.169.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rlcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskak
gptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcel
kkfwickksatpc

Timeline for d3zhgd_:

• d3zhgd_ first appeared in SCOPe 2.03
  
• d3zhgd_ appears in SCOPe 2.05
  
• d3zhgd_ appears in SCOPe 2.07
  
• d3zhgd_ appears in the current release, SCOPe 2.08