Lineage for d3zi4a_ (3zi4 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883352Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 1883353Protein beta-Phosphoglucomutase [75174] (2 species)
  7. 1883354Species Lactococcus lactis [TaxId:1358] [75175] (17 PDB entries)
  8. 1883362Domain d3zi4a_: 3zi4 A: [236104]
    automated match to d1o08a_
    complexed with bg6, mg, sfl

Details for d3zi4a_

PDB Entry: 3zi4 (more details), 1.33 Å

PDB Description: the structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d3zi4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zi4a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlq

SCOPe Domain Coordinates for d3zi4a_:

Click to download the PDB-style file with coordinates for d3zi4a_.
(The format of our PDB-style files is described here.)

Timeline for d3zi4a_: