![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (32 species) not a true protein |
![]() | Species Plasmodium vivax [TaxId:5855] [234134] (7 PDB entries) |
![]() | Domain d2ynda1: 2ynd A:26-210 [236101] automated match to d1iica1 complexed with 646, cl, dms, mg, nhw, so4 |
PDB Entry: 2ynd (more details), 1.89 Å
SCOPe Domain Sequences for d2ynda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ynda1 d.108.1.0 (A:26-210) automated matches {Plasmodium vivax [TaxId: 5855]} idykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp vsdar
Timeline for d2ynda1: