SCOPe 2.06: Domain d1blbc1: 1blb C:-8-85

Lineage for d1blbc1 (1blb C:-8-85)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
sandwich; 8 strands in 2 sheets; greek-key
duplication: has internal pseudo twofold symmetry
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
Protein beta-Crystallin [49702] (4 species)
duplication consists of two domains of this fold
Species Cow (Bos taurus) [TaxId:9913] [49703] (2 PDB entries)
Domain d1blbc1: 1blb C:-8-85 [23610]

Details for d1blbc1

PDB Entry: 1blb (more details), 3.3 Å

PDB Description: close packing of an oligomeric eye lens beta-crystallin induces loss of symmetry and ordering of sequence extensions

PDB Compounds: (C:) beta b2-crystallin

SCOPe Domain Sequences for d1blbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blbc1 b.11.1.1 (C:-8-85) beta-Crystallin {Cow (Bos taurus) [TaxId: 9913]}
agkpqplnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanck
geqfvfekgeyprwdswtssrrtdslsslrpikvds

SCOPe Domain Coordinates for d1blbc1:

Click to download the PDB-style file with coordinates for d1blbc1.
(The format of our PDB-style files is described here.)

Timeline for d1blbc1: