![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.13: Lectin leg-like [74904] (4 proteins) mammalian protein related to legume lectins automatically mapped to Pfam PF03388 |
![]() | Protein automated matches [190462] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [197238] (11 PDB entries) |
![]() | Domain d3whua_: 3whu A: [236098] automated match to d4gkya_ complexed with ca, gol |
PDB Entry: 3whu (more details), 2.6 Å
SCOPe Domain Sequences for d3whua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3whua_ b.29.1.13 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf enwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkkn npaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngft pdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfql
Timeline for d3whua_: