Lineage for d3whua_ (3whu A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051546Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 2051568Protein automated matches [190462] (2 species)
    not a true protein
  7. 2051574Species Human (Homo sapiens) [TaxId:9606] [197238] (11 PDB entries)
  8. 2051596Domain d3whua_: 3whu A: [236098]
    automated match to d4gkya_
    complexed with ca, gol

Details for d3whua_

PDB Entry: 3whu (more details), 2.6 Å

PDB Description: crystal structure of ergic-53/mcfd2, calcium/man2-bound form
PDB Compounds: (A:) Protein ERGIC-53

SCOPe Domain Sequences for d3whua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3whua_ b.29.1.13 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf
enwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkkn
npaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngft
pdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfql

SCOPe Domain Coordinates for d3whua_:

Click to download the PDB-style file with coordinates for d3whua_.
(The format of our PDB-style files is described here.)

Timeline for d3whua_: