SCOPe 2.08: Domain d3w6ua2: 3w6u A:162-283

Lineage for d3w6ua2 (3w6u A:162-283)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Pyrobaculum calidifontis [TaxId:410359] [236095] (4 PDB entries)

8. Domain d3w6ua2: 3w6u A:162-283 [236096]
   Other proteins in same PDB: d3w6ua1
   automated match to d1vpda1
   complexed with nap

Details for d3w6ua2

PDB Entry: 3w6u, 2 Å

PDB Description: crystal structure of nadp bound l-serine 3-dehydrogenase from hyperthermophilic archaeon pyrobaculum calidifontis

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, NAD-binding protein

SCOPe Domain Sequences for d3w6ua2:

Sequence, based on SEQRES records:

>d3w6ua2 a.100.1.0 (A:162-283) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
pvgygqamklvnqvvvalntvamveglklakalgldmdkvaevltrgaarsgaielylpk
llkgdlspgfkaehlkkdlgyvleearkrgvklpgaelayelyrkmvedgagslgihalg
fy

Sequence, based on observed residues (ATOM records):

>d3w6ua2 a.100.1.0 (A:162-283) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
pvgygqamklvnqvvvalntvamveglklakalgldmdkvaevltrsgaielylpkllkg
dlspgfkaehlkkdlgyvleearkrgvklpgaelayelyrkmvedgagslgihalgfy

Timeline for d3w6ua2:

• d3w6ua2 first appeared in SCOPe 2.03
  
• d3w6ua2 appears in SCOPe 2.07