Lineage for d3w6ua1 (3w6u A:1-161)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1351016Species Pyrobaculum calidifontis [TaxId:410359] [189396] (3 PDB entries)
  8. 1351019Domain d3w6ua1: 3w6u A:1-161 [236094]
    Other proteins in same PDB: d3w6ua2
    automated match to d1vpda2
    complexed with nap

Details for d3w6ua1

PDB Entry: 3w6u (more details), 2 Å

PDB Description: crystal structure of nadp bound l-serine 3-dehydrogenase from hyperthermophilic archaeon pyrobaculum calidifontis
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, NAD-binding protein

SCOPe Domain Sequences for d3w6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w6ua1 c.2.1.0 (A:1-161) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
mrvgfiglgimggpmathllkagflaavynrtrektkpfaeagvyvaespadlakrvdvv
ivmvsdapdveqvlfgpsgvvegarpglivvdmstnspdwarkfaerlaqygiefldapv
tggqkgaiegtltimvggkeelfhrllpifkamgrdivymg

SCOPe Domain Coordinates for d3w6ua1:

Click to download the PDB-style file with coordinates for d3w6ua1.
(The format of our PDB-style files is described here.)

Timeline for d3w6ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3w6ua2