| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (159 species) not a true protein |
| Species Pyrobaculum calidifontis [TaxId:410359] [189396] (3 PDB entries) |
| Domain d3w6ua1: 3w6u A:1-161 [236094] Other proteins in same PDB: d3w6ua2 automated match to d1vpda2 complexed with nap |
PDB Entry: 3w6u (more details), 2 Å
SCOPe Domain Sequences for d3w6ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w6ua1 c.2.1.0 (A:1-161) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
mrvgfiglgimggpmathllkagflaavynrtrektkpfaeagvyvaespadlakrvdvv
ivmvsdapdveqvlfgpsgvvegarpglivvdmstnspdwarkfaerlaqygiefldapv
tggqkgaiegtltimvggkeelfhrllpifkamgrdivymg
Timeline for d3w6ua1: