SCOPe 2.03: Domain d4oa8b_: 4oa8 B:

Lineage for d4oa8b_ (4oa8 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (42 species)
   not a true protein

7. Species Anaplasma phagocytophilum [TaxId:212042] [236090] (2 PDB entries)

8. Domain d4oa8b_: 4oa8 B: [236092]
   automated match to d3c3pa_
   complexed with edo, na

Details for d4oa8b_

PDB Entry: 4oa8, 2.15 Å

PDB Description: x-ray crystal structure of o-methyltransferase from anaplasma phagocytophilum in apo form

PDB Compounds: (B:) O-methyltransferase family protein

SCOPe Domain Sequences for d4oa8b_:

Sequence; same for both SEQRES and ATOM records:

>d4oa8b_ c.66.1.0 (B:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
lskqdeylnklfavdtegalkahktapselrmaqlgtvegqmlqllirmagihsivevgt
cvgfsaicmahalpskghiytiekdyenvvtanqnivnckledkitvlhgealaqlntlk
emapfdmifidankssylaylnwakmyirkgglivadntflfgsvfdehptekvssnaha
smrafndelankekylstiiptsegmmvsiklt

Timeline for d4oa8b_:

• d4oa8b_ is new in SCOPe 2.03-stable
  
• d4oa8b_ appears in SCOPe 2.04
  
• d4oa8b_ appears in the current release, SCOPe 2.08