SCOP 1.69: Domain d1blbb2: 1blb B:86-175

Lineage for d1blbb2 (1blb B:86-175)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
sandwich; 8 strands in 2 sheets; greek-key
duplication: has internal pseudo twofold symmetry
Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
Protein beta-Crystallin [49702] (4 species)
duplication consists of two domains of this fold
Species Cow (Bos taurus) [TaxId:9913] [49703] (2 PDB entries)
Domain d1blbb2: 1blb B:86-175 [23609]

Details for d1blbb2

PDB Entry: 1blb (more details), 3.3 Å

PDB Description: close packing of an oligomeric eye lens beta-crystallin induces loss of symmetry and ordering of sequence extensions

SCOP Domain Sequences for d1blbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blbb2 b.11.1.1 (B:86-175) beta-Crystallin {Cow (Bos taurus)}
qehkitlyenpnftgkkmevidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqy
llekgdykdsgdfgapqpqvqsvrrirdmqw

SCOP Domain Coordinates for d1blbb2:

Click to download the PDB-style file with coordinates for d1blbb2.
(The format of our PDB-style files is described here.)

Timeline for d1blbb2: