SCOPe 2.03: Domain d4o8aa2: 4o8a A:262-610

Lineage for d4o8aa2 (4o8a A:262-610)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.23: FAD-linked oxidoreductase [51730] (2 families)
   distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation

5. Family c.1.23.2: Proline dehydrohenase domain of bifunctional PutA protein [82279] (2 proteins)
   automatically mapped to Pfam PF01619

6. Protein automated matches [226993] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [225601] (4 PDB entries)

8. Domain d4o8aa2: 4o8a A:262-610 [236089]
   Other proteins in same PDB: d4o8aa1
   automated match to d1k87a2
   complexed with 2op, fad, pg4

Details for d4o8aa2

PDB Entry: 4o8a, 2 Å

PDB Description: First structure of a proline utilization A proline dehydrogenase domain

PDB Compounds: (A:) Bifunctional protein putA

SCOPe Domain Sequences for d4o8aa2:

Sequence; same for both SEQRES and ATOM records:

>d4o8aa2 c.1.23.2 (A:262-610) automated matches {Escherichia coli [TaxId: 83333]}
getiaealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiy
egpgisiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisl
dlleklcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdse
ikraqmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagq
nyypgqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrlleng
antsfvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprd

Timeline for d4o8aa2:

• d4o8aa2 is new in SCOPe 2.03-stable
  
• d4o8aa2 appears in SCOPe 2.04
  
• d4o8aa2 appears in the current release, SCOPe 2.08