SCOPe 2.07: Domain d4o8aa1: 4o8a A:88-261

Lineage for d4o8aa1 (4o8a A:88-261)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
   multihelical; array

4. Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families)

5. Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)

6. Protein N-terminal domain of bifunctional PutA protein [81937] (2 species)
   includes the N-terminal swapping arm made of three helices; possible DNA-binding function

7. Species Escherichia coli [TaxId:562] [81938] (7 PDB entries)
   Uniprot P09546 87-610

8. Domain d4o8aa1: 4o8a A:88-261 [236088]
   Other proteins in same PDB: d4o8aa2
   complexed with 2op, fad, pg4

Details for d4o8aa1

PDB Entry: 4o8a, 2 Å

PDB Description: First structure of a proline utilization A proline dehydrogenase domain

PDB Compounds: (A:) Bifunctional protein putA

SCOPe Domain Sequences for d4o8aa1:

Sequence, based on SEQRES records:

>d4o8aa1 a.176.1.1 (A:88-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvn
aatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records):

>d4o8aa1 a.176.1.1 (A:88-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllslssqegvalmclaeallripdkatrdallirkgvdmamrlmgeqfvt

Timeline for d4o8aa1:

• d4o8aa1 first appeared in SCOPe 2.03
  
• d4o8aa1 appears in SCOPe 2.06
  
• d4o8aa1 appears in the current release, SCOPe 2.08